PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009788120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 583aa    MW: 65246.8 Da    PI: 7.0402
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009788120.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.63.3e-1292145822373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     + lL++cA+a+++++l    +l+a+ ++  s +gdp+qRl ay++e+L ar   s++++y+al+++e +     + l+++++++e++P+lkf+++
  XP_009788120.1 214 KPLLIACARALTENKLDDFGSLIAKARNAISITGDPIQRLGAYIVEGLVARKEASGTNIYRALRCKEPA---GRDLLSYMHILYEICPYLKFGYM 305
                     568*****************************************************************9...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     +aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + l  +g+rL+++ e++++p+ef++ v     ++
  XP_009788120.1 306 AANGAIAEACRNEDRIHIIDFQIAQGTQWMTLLQALAARPSGAPHVRITGIDDPVSKyaRGDGLAFVGKRLTDISEKFNIPVEFHA-VPVFAPEV 399
                     ******************************************************999999**************************.6888999* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     + ++L+v+pgEalaVn+ l lh+++desv+++++rde+L++vkslsPkvv++veqe+++n+++F+ rfleal+yy a+f+s++++l r+ +eri+
  XP_009788120.1 400 TRDMLDVRPGEALAVNFPLVLHHTPDESVDVTNPRDELLRMVKSLSPKVVTLVEQESNTNTAPFFPRFLEALDYYCAMFESIDVTLERDRKERIN 494
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     vE+++l+r+ivnv+aceg+er+erhe l+kW+ r+++aGF+++pls+++++ +k+llr ++ + y++ e++g+++lgWkdr+L+s+SaW
  XP_009788120.1 495 VEQHCLARDIVNVIACEGKERVERHELLGKWKLRFTMAGFRQYPLSSYVNSVIKSLLRCYS-EHYTLVEKDGAMLLGWKDRNLISASAW 582
                     *********************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.39187564IPR005202Transcription factor GRAS
PfamPF035141.1E-126214582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MESHHLYGYG VTGANLSYSY SKAATTTPLP NRLLGTLKFE SRNSPNSPFA NYFDPDTPTT  60
LSDSLEQHRS TENISETSPS NSSLDYNHYF HRPSPSPNFR PNTLLVRSGE TSLLQYANHS  120
QNMKNALLQL ETALMGPEEE ATTSSPSAGD IKQPQTSGQR SRMWNQEDQI SRRIERQPSH  180
VSTFGISSSG IHSEKRHKAT EDLSLSGIPS GNLKPLLIAC ARALTENKLD DFGSLIAKAR  240
NAISITGDPI QRLGAYIVEG LVARKEASGT NIYRALRCKE PAGRDLLSYM HILYEICPYL  300
KFGYMAANGA IAEACRNEDR IHIIDFQIAQ GTQWMTLLQA LAARPSGAPH VRITGIDDPV  360
SKYARGDGLA FVGKRLTDIS EKFNIPVEFH AVPVFAPEVT RDMLDVRPGE ALAVNFPLVL  420
HHTPDESVDV TNPRDELLRM VKSLSPKVVT LVEQESNTNT APFFPRFLEA LDYYCAMFES  480
IDVTLERDRK ERINVEQHCL ARDIVNVIAC EGKERVERHE LLGKWKLRFT MAGFRQYPLS  540
SYVNSVIKSL LRCYSEHYTL VEKDGAMLLG WKDRNLISAS AWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-632175838375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788120.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_009788119.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_016475625.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLC6ZH460.0C6ZH46_CAPAN; Scarecrow-like protein
STRINGSolyc07g063940.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein